PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G384300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family SAP
Protein Properties Length: 454aa    MW: 50841.9 Da    PI: 6.3615
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G384300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP517.85.1e-15814521454
                SAP   1 mssssssssseseegseg..geggdassgesegpsssrqraanevwpePflealatqvaidasrslGrlaaasalanvfqvcstwravsrsd 90 
                        mssssss+++es++  +   +++++    +s ++sss++   nevwpePfleal +qva+da ++lG l+ a+al nvfqvc+tw+a+srsd
  Aqcoe1G384300.1.p   1 MSSSSSSDDEESGNRRRDyyHHQFEGP-SSSRQRSSSSSSYNNEVWPEPFLEALVYQVAVDAVQTLGPLSVAPALSNVFQVCTTWQAISRSD 91 
                        888888877766655433003334433.34445566666678************************************************** PP

                SAP  91 llwqrltrriWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsCrclalsdkylaaGfadGavrlfdletrlh 182
                        +lw++ltr+iW+r  ll++tW+ ey y hrt +nfrtrr  y++l + + +vd d++ + l+Cr+lalsd +la+G++dG++rlfdl+trlh
  Aqcoe1G384300.1.p  92 HLWRNLTRQIWHRDVLLHNTWQSEYHYLHRTCSNFRTRRAVYTSLVIPQEYVDVDDNHNFLTCRRLALSDYHLACGLVDGSIRLFDLTTRLH 183
                        *****************************************************99999********************************** PP

                SAP 183 vstflpqhrdrlGrfsravsGivisdsrlvfatldGdihvavi.dgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGrafhiWd 273
                        vstf+pq+rd+lG fsravsGiv+++s+lvfa+ldGd+hvavi +g++  ++rr++lG+vvndG +           GlyaGvpGr+fh+W+
  Aqcoe1G384300.1.p 184 VSTFRPQQRDHLGLFSRAVSGIVLTESQLVFASLDGDLHVAVIgNGENPNNPRRVQLGNVVNDGNF-----------GLYAGVPGRSFHVWN 264
                        *******************************************44556899*************74...........*************** PP

                SAP 274 aeteelvfvGGsltdPeavmGWhmlteltelvGrvrvt....ere..tavaCtslrlvvfdlrnqg...vvlreeeer..rGlivssldas. 353
                        aete+l          ++vmGWh+ltel +++Grvr+     +re  ++va t++rl+++++rn++   vvl+eee+   r liv s+d+s 
  Aqcoe1G384300.1.p 265 AETEQL----------KSVMGWHLLTELNDSIGRVRIVtsfnQREsvVVVASTAIRLMSLEIRNHDgmmVVLNEEEQVveRSLIVDSVDVSs 346
                        ****98..........699*****************85233223422678**************94344778877776779********962 PP

                SAP 354 .neayvvvdsrG.vatvrrvenleevcrfrvrg....aqrgvlgCvnggyalvyaggvlrvWeiekkegylyslrervgevnalvaddrhva 439
                          e ++ vd+r   a++r+v ++eevcrfr+rg      +g++gC+ngg + +++ggv+r+W+  + e  ly+l++r+gev al+addrhva
  Aqcoe1G384300.1.p 347 nTERFILVDNRQrFARIRQVGDFEEVCRFRIRGggggGGGGLMGCINGGCVFIWSGGVIRAWDARNGE-VLYNLTDRIGEVTALIADDRHVA 437
                        25779999987527******************876656789**********************99866.*********************** PP

                SAP 440 vsssdgtihlldfga 454
                         + +dgtihl+dfga
  Aqcoe1G384300.1.p 438 CTCADGTIHLWDFGA 452
                        **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.1280.505.8E-773148No hitNo description
SuperFamilySSF813833.05E-774122IPR001810F-box domain
SMARTSM0032044139177IPR001680WD40 repeat
SuperFamilySSF509781.28E-16152221IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.101.1E-14160450IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509781.28E-16261450IPR017986WD40-repeat-containing domain
PROSITE profilePS502948.545403453IPR017986WD40-repeat-containing domain
SMARTSM003200.36412449IPR001680WD40 repeat
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MSSSSSSDDE ESGNRRRDYY HHQFEGPSSS RQRSSSSSSY NNEVWPEPFL EALVYQVAVD  60
AVQTLGPLSV APALSNVFQV CTTWQAISRS DHLWRNLTRQ IWHRDVLLHN TWQSEYHYLH  120
RTCSNFRTRR AVYTSLVIPQ EYVDVDDNHN FLTCRRLALS DYHLACGLVD GSIRLFDLTT  180
RLHVSTFRPQ QRDHLGLFSR AVSGIVLTES QLVFASLDGD LHVAVIGNGE NPNNPRRVQL  240
GNVVNDGNFG LYAGVPGRSF HVWNAETEQL KSVMGWHLLT ELNDSIGRVR IVTSFNQRES  300
VVVVASTAIR LMSLEIRNHD GMMVVLNEEE QVVERSLIVD SVDVSSNTER FILVDNRQRF  360
ARIRQVGDFE EVCRFRIRGG GGGGGGGLMG CINGGCVFIW SGGVIRAWDA RNGEVLYNLT  420
DRIGEVTALI ADDRHVACTC ADGTIHLWDF GAI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270208.11e-147PREDICTED: transcriptional regulator STERILE APETALA
TrEMBLA0A067K1B31e-138A0A067K1B3_JATCU; Uncharacterized protein
STRINGSolyc05g041220.1.11e-122(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-111SAP family protein